HPA019592

Anti-S100A13 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-S100 calcium binding protein A13
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA019592
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: rat, human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Immunogene Sequenz: ELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKI
• UniProt-Hinterlegungsnummer: Q99584
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... S100A13(6284)

Beschreibung

Immunogen

S100 calcium binding protein A13 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-S100A13 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

S100A13 (S100 calcium binding protein A13) is a calcium binding protein belonging to the S100 protein family. Generally, members of this family are associated with several cellular activities such as proliferation, motility, and survival. It has been reported that members of S100 family has clinical impact on tumor growth and disease progression. S100A13 has been accounted as a potential therapeutic target in papillary carcinomas (PTC), therefore it has the potential to be a novel candidate PTC biomarker. S100A13 also participates in cell signaling pathways relevant to cell cycle progression and differentiation, cytokine and NFKB signaling, and in melanoma progression and angiogenesis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74509

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable