HPA018297

Anti-USP25 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Deubiquitinating enzyme 25, Anti-USP on chromosome 21, Anti-Ubiquitin carboxyl-terminal hydrolase 25, Anti-Ubiquitin thioesterase 25, Anti-Ubiquitin-specific-processing protease 25
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA018297
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: QPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK
• UniProt-Hinterlegungsnummer: Q9UHP3
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... USP25(29761)

Beschreibung

Allgemeine Beschreibung

The gene USP25 (ubiquitin-specific-processing protease 25) has been mapped to human chromosome 21q11.2. It contains three ubiquitin binding domains at the amino-terminus: one ubiquitin-associated domain and two ubiquitin-interacting motifs. USP25 encodes three different protein isoforms produced by alternate splicing: two are expressed ubiquitously and the longest is restricted to muscle tissues. USP25 is mainly present in the cytoplasm.

Immunogen

Ubiquitin carboxyl-terminal hydrolase 25 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

Ubiquitin-specific-processing protease 25 (USP25) is a specific-ubiquitin protease gene. SUMOylation of USP25 impairs its activity by reducing the affinity to ubiquitin chains. In muscle tissues, USP25 is up-regulated during myogenesis. USP25 interacts with myosisn binding protein C1 and protects the latter from degradation which is important in muscle differentiation and maintenance. USP25 is a negative regulator of the virus-triggered type I interferon (IFN) signalling pathway. RT-PCR analysis showed up-regulation of USP25 in Down′s syndrome fetal brains in mouse model. USP25 is down-regulated in human lung cancer. MiR-200c exerts tumor-suppressive effects of non-small-cell lung cancer though suppression of USP25 expression.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73924

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)