HPA014736

Anti-SLC13A3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Na(+)/dicarboxylate cotransporter 3, Anti-NaDC-3, Anti-Sodium-dependent high-affinity dicarboxylate transporter 2, Anti-Solute carrier family 13 member 3, Anti-hNaDC3
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA014736
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL
• UniProt-Hinterlegungsnummer: Q8WWT9
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC13A3(64849)

Beschreibung

Allgemeine Beschreibung

SLC13A3 (solute carrier family 13, member 3) belongs to SLC13 family of five members. This family is divided into Na⁺-sulphate (NaS) cotransporters and Na⁺-carboxylate (NaC) cotransporters, and SLC13A3 belongs to the latter group. It is a transporter with 12 transmembrane regions, and is composed of 602 amino acids. This gene maps to human chromosome 20q12-13.1, spans more than 80kb, and has 13 exons, and 12 introns. It has three predicted N-linked glycosylation sites. It is localized to the proximal tubule cells in the basolateral membrane. It is also expressed in brain, liver, pancreas and placenta.

Immunogen

Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

SLC13A3 (solute carrier family 13, member 3) acts in collaboration with organic anion transporter 1 (OAT1) and OAT3) to facilitate the release of multiple endogenous and exogenous organic ions. It provides intracellular α-ketoglutarate, in a Na⁺-dependent manner, to OAT1 and 3, to allow for organic anion/dicarboxylate exchange. It is a glutathione (GSH) transporter of low-affinity. It is responsible for the uptake of GSH by the proximal tubule cells of basolateral membrane, in a sodium-dependent manner. Mutations in this gene might have a link to idiopathic nephrolithiasis. This transporter is also responsible for the uptake of N-carbamoylglutamate (NCG) from blood. NCG is a drug which is used to treat inborn n-acetylglutamate synthase deficiency. SLC13A3 might be involved in myelination, as it is responsible for the Na⁺-dependent transport of N-acetylaspartate in brain.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73142

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)