HPA009160

Anti-NDFIP2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-NEDD4 WW domain-binding protein 5A antibody produced in rabbit, Anti-NEDD4 family-interacting protein 2 antibody produced in rabbit, Anti-Putative MAPK-activating protein PM04/PM05/PM06/PM07 antibody produced in rabbit, Anti-Putative NF-κ-B-activating protein 413 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA009160
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Immunogene Sequenz: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN
• UniProt-Hinterlegungsnummer: Q9NV92
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NDFIP2(54602)

Beschreibung

Allgemeine Beschreibung

NDFIP2 (Nedd4 family interacting protein 2) is a small PY element-containing membrane protein. It is a mammalian ortholog of Bsd2, a protein found in Saccharomyces cerevisiae. It is highly identical to NDFIP1. Its N-terminal domain is located at the cytosolic region and contains the PY motifs. It also consists of three transmembrane domains. It is a member of the NEDD (neural precursor cell expressed developmentally down-regulated protein) 4-binding protein family.

Immunogen

NEDD4 family-interacting protein 2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

NDFIP2 (Nedd4 family interacting protein 2) functions as a recruiter and activator of multiple NEDD (neural precursor cell expressed developmentally down-regulated protein) 4 proteins in vivo. In vitro it interacts with and activates ITCH protein and various other HECT (homologous to the E6-AP carboxyl terminus) ligases. It also facilitates the ubiquitination of Jun proteins containing a PY motif, as well as that of endophilin, which lacks PY motif. It might suppress the ubiquitylation of PY-containinf proteins, such as connexin-43, by Nedd4, in a competitive manner. This protein has a high level of expression in native renal collecting duct and other tissues expressing ENaC (epithelial sodium channels). Thus, this protein might be implicated in the regulation of ENaC physiological functions. In T-cells, this protein might be responsible for controlling the activity of NEDD4 at the level of Golgi bodies.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71203

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)