HPA003239

Anti-PCMT1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-L-Isoaspartyl protein carboxyl methyltransferase antibody produced in rabbit, Anti-PIMT antibody produced in rabbit, Anti-Protein L-isoaspartyl/D-aspartyl methyltransferase antibody produced in rabbit, Anti-Protein-β-aspartate methyltransferase antibody produced in rabbit, Anti-Protein-L-isoaspartate(D-aspartate) O-methyltransferase antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA003239
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: rat, mouse, human
• Erweiterte Validierung: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
• UniProt-Hinterlegungsnummer: P22061
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PCMT1(5110)

Beschreibung

Allgemeine Beschreibung

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) gene encodes a protein that belongs to type II class of protein carboxyl methyltransferase enzymes. This gene is mapped to human chromosome 6q24-25.

Immunogen

Protein-L-isoaspartate(D-aspartate) O-methyltransferase recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-PCMT1 antibody produced in rabbit is suitable for use in proteome-wide epitope mapping covering all human proteins for on- and off-target binding analysis.
Anti-PCMT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) protein repairs modified proteins by catalyzing the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that are formed from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It negatively regulates p53, a tumour suppressor protein, and in turn downregulates p53-mediated transcription of target genes. It may serve as a therapeutic target for cancers. It protects neural cells from Bax-induced apoptosis and defects in this gene may cause spina bifida in infants. It activates integrin αv and mediates cell adhesion in various cancer cell lines. The protein negatively regulates β−amyloid peptide formation and plays a protective role in Alzheimer′s disease pathogenesis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST79907

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)