HPA001429

Anti-NBN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Cell cycle regulatory protein p95, Anti-Nibrin, Anti-Nijmegen breakage syndrome protein 1
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA001429
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
• UniProt-Hinterlegungsnummer: O60934
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NBN(4683)

Beschreibung

Allgemeine Beschreibung

NBN (nibrin) is a part of a highly conserved protein complex, which also includes MRE11 and RAD50 proteins. This complex is essential in recognition and signaling of DNA double-strand break (DSB). Functionally, this protein can be divided into two domains- C-terminal contains MRE11 (meiotic recombination 11 homolog A)- and ATM (ataxia telangiectasia-mutated) kinase-binding domains. Its N-terminal is responsible for phosphor-dependent protein-protein interactions and contains forkhead-associated (FHA) and breast cancer C-terminal (BRCT).

Immunogen

Nibrin recombinant protein epitope signature tag (PrEST)

Anwendung

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

NBN (nibrin) is involved in DNA double-strand break repair. It activates DNA damage-induced checkpoint. Defects in this gene are associated with Nijmegen breakage syndrome that is characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. It plays a role in tumorigenesis, and this gene is mutated in breast and colorectal cancer, primary glioblastoms and medulloblastoma, acute lymphoblastic leukemia (ALL) and other lymphoid malignancies.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST78218

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)