AV53597
Anti-INHA antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-Inhibin, α
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(1)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
40 kDa
Speziesreaktivität
bovine, goat, sheep, human, pig
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... INHA(3623)
Allgemeine Beschreibung
NHA (inhibin, alpha) gene encodes the alpha subunit of inhibins A and B protein complexes that belongs to TGF-beta family. It is localized in the syncytiotrophoblast and the intermediate trophoblast of the placenta and may play a role in the mechanism of labor. INHA is also known as Inhibin α. Activin and inhibin are two closely related protein complexes involved in follicle-stimulating hormone (FSH) synthesis. They are produced in the gonads, pituitary gland, placenta, corpus luteum and other organs.
Immunogen
Synthetic peptide directed towards the N terminal region of human INHA
Anwendung
Anti-INHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem./physiol. Wirkung
Inhibins facilitates the regulation of numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Loss of expression of inhibinα results in high grade prostate cancer. Follicle-stimulating hormone (FSH) stimulates the secretion of inhibin from the granulosa cells of the ovarian follicles in the ovaries. In turn, inhibin suppresses FSH. Inhibin secretion is diminished by GHRH, and enhanced by insulin-like growth factor-1. Inhibin may involve competing with activin for binding to activin receptors and binding to inhibin-specific receptors. Activin, inhibin and follistatin participate as intraovarian regulatory molecules involved in follicular cell proliferation, differentiation, steroidogenesis, oocyte maturation and corpus luteum function.
Sequenz
Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
G M Lambert-Messerlian et al.
Molecular and cellular endocrinology, 225(1-2), 101-108 (2004-09-29)
To date, the only routine clinical application of inhibin or activin measurement in testing for fetal abnormalities has been the use of inhibin A in prenatal screening for trisomy 21 (Down syndrome). Second trimester maternal serum levels of inhibin A
Stefano Luisi et al.
Human reproduction update, 11(2), 123-135 (2004-12-25)
A great deal of new information has arisen in the recent years concerning inhibin physiology and clinical relevance in reproductive medicine. It is now recognized that the two inhibin isoforms, named inhibin A and inhibin B, are produced by the
P van Zonneveld et al.
Human reproduction (Oxford, England), 18(3), 495-501 (2003-03-05)
The cause of declining fertility with age, in women who still have regular menstrual cycles, is not clear. Follicle development, endometrial growth and hormonal patterns were evaluated in cycles of older women (aged 41-46 years; n = 26) who previously
Matías L Stangaferro et al.
Animal reproduction science, 148(3-4), 97-108 (2014-07-09)
Cystic ovarian disease (COD) is an important cause of infertility in dairy cattle. Although many researchers have focused their work on the endocrine changes related to this disease, evidence indicates that intraovarian components play an important role in follicular persistence.
A Kondi-Pafiti et al.
Clinical and experimental obstetrics & gynecology, 40(1), 109-112 (2013-06-04)
The aim of the study was to examine, by an immunohistochemical method, the distribution of Inhibin-A and -B, in placentas from normal and pathological gestations. Sixty-two specimens of placental tissue were examined: i) ten cases from early gestations, ii) 28
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.