Direkt zum Inhalt
Merck

AV49932

Sigma-Aldrich

Anti-PLXNA2 antibody produced in rabbit

affinity isolated antibody

Synonym(e):

Anti-FLJ11751, Anti-FLJ30634, Anti-KIAA0463, Anti-OCT, Anti-PLXN2, Anti-Plexin A2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

211 kDa

Speziesreaktivität

mouse, rat, horse, dog, guinea pig, rabbit, human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... PLXNA2(5362)

Allgemeine Beschreibung

In the fetal samples, Plexin A2 (PLXNA2) has prominent expression in fetal neural tissue.

Immunogen

Synthetic peptide directed towards the N terminal region of human PLXNA2

Anwendung

Anti-PLXNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem./physiol. Wirkung

Plexin A2 (PLXNA2) is a coreceptor for semaphorins that are involved in immune responses, activation of immune cells and axon guidance during neuronal development. PLXNA2 acts as a receptor of Sema6A and has a role in limiting adult axon growth and recovery post trauma. PLXNA2 is up-regulated in metastatic prostate cancer tumors and breast cancer. Copy number variation in PLXNA2 is associated with Tetralogy of Fallot (TOF), a cyanotic congenital heart disease. Dysregulation of PLXNA2-semaphorin signaling results in congenital heart disease, characteristic of cardiac outflow tract (OFT) defect. PLXNA2 is up-regulated by osteogenic factor BMP2. Up-regulated PLXNA2 mediates osteoblast differentiation by regulation of RUNX2 (Runt-related transcription factor 2) expression.

Sequenz

Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

T V Tian et al.
Oncogene, 33(17), 2204-2214 (2013-05-28)
Prostate cancer (PCa) is one of the major public health problems in Western countries. Recently, the TMPRSS2:ERG gene fusion, which results in the aberrant expression of the transcription factor ERG, has been shown to be the most common gene rearrangement
Ji-Eun Oh et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 27(3), 552-562 (2011-11-19)
The imbalance between bone-resorbing osteoclasts and bone-forming osteoblasts often leads to bone destructive diseases such as osteoporosis. In contrast to the development of several antiresorptive agents for osteoporosis therapy, discovery of anabolic drugs has been difficult because of an insufficient
Sang-Ohk Shim et al.
Molecular and cellular neurosciences, 50(2), 193-200 (2012-05-09)
Axonal growth from both intact and severed fibers is limited after adult mammalian CNS injury. Myelin proteins contribute to inhibition of axonal growth. Semaphorin6A protein inhibits the extension of developing axons and is highly expressed in adult oligodendrocytes. This expression
Candice K Silversides et al.
PLoS genetics, 8(8), e1002843-e1002843 (2012-08-23)
Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about
P N Gabrovska et al.
Gene, 489(2), 63-69 (2011-09-20)
Gene expression profiling has enabled us to demonstrate the heterogeneity of breast cancers. The potential of a tumour to grow and metastasise is partly dependant on its ability to initiate angiogenesis or growth and remodelling of new blood vessels, usually

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.