AV48157

Anti-RPL3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-MGC104284, Anti-Ribosomal protein L3, Anti-TARBP-B
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 40 kDa
• Speziesreaktivität: rat, bovine, rabbit, guinea pig, horse, human, dog, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: XP_001718487
• UniProt-Hinterlegungsnummer: B3KS36
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... RPL3(6122)

Beschreibung

Allgemeine Beschreibung

Ribosomal protein L3 is a cytoplasmic protein that can bind to HIV-1 TAR mRNA and modulated transactivation mediated by Tat. Studies have reported that the autoregulatory circuit of RPL3 required KHSRO, NPM and H1 proteins. RPL3 gene is also known to be overexpressed in obesity models.
Rabbit Anti-RPL3 antibody recognizes human, mouse, rat, zebrafish, chicken, pig, and bovine RPL3.

Immunogen

Synthetic peptide directed towards the C terminal region of human RPL3

Anwendung

Rabbit Anti-RPL3 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem./physiol. Wirkung

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene′s introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Sequenz

Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable