AV46359

Anti-TARS antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-MGC9344, Anti-ThrRS, Anti-Threonyl-tRNA synthetase
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 78 kDa
• Speziesreaktivität: rabbit, rat, mouse, human, bovine, horse, dog, guinea pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_689508
• UniProt-Hinterlegungsnummer: Q5M7Z9
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TARS(6897)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human TARS

Anwendung

Anti-TARS antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem./physiol. Wirkung

TARS (threonyl-tRNA synthetase) gene also referred to as MGC9344 or ThrRS encodes for an enzyme belongs to class-II aminoacyl-tRNA synthetase family. It enhances the endothelial cell migration and angiogenesis.

Sequenz

Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable