AV36913

Anti-ASCL2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 29 kDa
• Speziesreaktivität: mouse, human, rat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_032580
• UniProt-Hinterlegungsnummer: O35885
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: mouse ... ASCL2(17173)

Beschreibung

Allgemeine Beschreibung

Achaete-scute complex homolog 2 (Drosophila), ASCL2, is a bHLH transcription factor. In mice it is expressed during the development of extraembroynic trophoblast lineages but repressed in other tissues and is essential for proper placental development.

Immunogen

Synthetic peptide directed towards the middle region of human ASCL2

Biochem./physiol. Wirkung

Mouse ASCL2 is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It is the first transcription factor shown to play a critical part in the development of the mammalian trophoblast lineage.

Sequenz

Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable