AV32208

Anti-GSH2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-GS homeobox 2, Anti-GSH2
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 32 kDa
• Speziesreaktivität: rabbit, bovine, dog, horse, human, pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_573574
• UniProt-Hinterlegungsnummer: Q9BZM3
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GSH2(170825)

Beschreibung

Allgemeine Beschreibung

GSH2 is a homeobox protein that regulates dorsoventral patterning in mammalian telencephalon.
Rabbit Anti-GSH2 antibody recognizes rat, human, mouse, and canine GSH2.

Immunogen

Synthetic peptide directed towards the N terminal region of human GSH2

Anwendung

Rabbit Anti-GSH2 antibody can be used for western blot applications at a concentration of 1μg/ml.

Biochem./physiol. Wirkung

homeobox protein GSH-2

Sequenz

Synthetic peptide located within the following region: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable