APREST94161

PrEST Antigen TRHR

Prestige Antigens Powered by Atlas Antibodies

• UNSPSC-Code: 12352203

Eigenschaften

• Rekombinant: expressed in E. coli
• Assay: >80% (SDS-PAGE)
• Form: buffered aqueous solution
• Mol-Gew.: predicted mol wt 23 kDa
• Aufgereinigt durch: immobilized metal affinity chromatography (IMAC)
• Konzentration: ≥0.5 mg/mL
• Immunogene Sequenz: ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
• Ensembl | Human Hinterlegungsnummer: ENSG00000174417
• UniProt-Hinterlegungsnummer: P34981
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... TRHR(7201)

Beschreibung

Allgemeine Beschreibung

Recombinant protein fragment of Human TRHR with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Anwendung

Blocking agent and positive assay control using corresponding antibodies.

Physikalische Form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Angaben zur Herstellung

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable