Direkt zum Inhalt
Merck
Alle Fotos(10)

Wichtige Dokumente

AMAB91030

Sigma-Aldrich

Monoclonal Anti-NEFM antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2705, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(e):

NEF3, NF-M, NFM

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

CL2705, monoclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

mouse, rat, human

Methode(n)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:5000- 1:10000

Isotyp

IgG2b

Immunogene Sequenz

YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... NEFM(4741)

Allgemeine Beschreibung

Neurofilament medium (NEFM) gene encodes neurofilament medium polypeptide which constitutes to cytoskeleton of mature neurons. The gene in human chromosome is localized on 8p21.

Immunogen

neurofilament, medium polypeptide

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Neurofilament medium (NEFM) is essential for radial growth of axon which includes the diameter of the axon as well as the myelination. The C-terminus of NFEM gene has 7 repeats of KSP (lysine-serine-proline) domain and phosphorylation of which is crucial for regulating the radial growth of axon. NEFM is related to several cancers especially breast cancers in which NEFM gene silencing by methylation leads to disease progression. Mutations in NEFM results in decreased diameter of axon and hence deficiency of neurons.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physikalische Form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Assembly and structure of neurofilaments
Janmey PA, et al.
Current Opinion in Colloid & Interface Science, 8(1), 40-47 (2003)
Epigenetic silencing of neurofilament genes promotes an aggressive phenotype in breast cancer
Calmon MF, et al.
Epigenetics, 10(7), 622-632 (2015)
Expansion of neurofilament medium C terminus increases axonal diameter independent of increases in conduction velocity or myelin thickness
Barry DM, et al.
The Journal of Neuroscience, 32(18), 6209-6219 (2012)
NF-M is an essential target for the myelin-directed ?outside-in? signaling cascade that mediates radial axonal growth
Garcia ML, et al.
The Journal of Cell Biology, 163(5), 1011-1020 (2003)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.