Direkt zum Inhalt
Merck

AMAB90730

Sigma-Aldrich

Monoclonal Anti-WWTR1 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0371, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(e):

DKFZp586I1419, TAZ

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

CL0371, monoclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:50- 1:200

Isotyp

IgG1

Ensembl | Human Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... WWTR1(25937)

Verwandte Kategorien

Allgemeine Beschreibung

WWTR1 (WW domain containing transcription regulator 1) is also known as TAZ (transcriptional co-activator with PDZ-binding motif). It is a transcriptional coactivator with a N-terminal TEAD-binding motif and without a DNA-binding motif. TAZ is a 14-3-3 binding protein that is expressed at high level in thyroid, kidney, heart, placenta and lung. It is present in cytoplasm and nucleus. The WWTR1 gene is located on human chromosome 3q25.1.

Immunogen

Recombinant protein corresponding to WW domain containing transcription regulator 1.

Sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST

Epitope
Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

WWTR1(WW domain containing transcription regulator 1)/TAZ (transcriptional co-activator with PDZ-binding motif) stimulates the multiplication of glioma cell and represses the apoptosis of glioma cells. TEADs are important interacting transcription factors of TAZ, which serve as effectors to promote cell proliferation, migration and epithelial-mesenchymal transition. TAZ participates in mesenchymal stem cell differentiation. It plays a vital role in mechanotransduction. Overexpression of TAZ leads to increased cell proliferation, epithelial-mesenchymal transition (EMT), cell migration and transformation.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70841

Physikalische Form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

WWTR1 (WW domain containing transcription regulator 1).
Zhao Y and Yang X
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 18(11), 849-849 (2014)
The role of transcriptional coactivator TAZ in gliomas.
Li W, et al.
Oncotarget, 7(50), 82686?82699-82686?82699 (2016)
Patricia García et al.
Cancers, 12(4) (2020-03-29)
Gallbladder cancer is an aggressive disease with late diagnosis and no efficacious treatment. The Hippo-Yes-associated protein 1 (YAP1) signaling pathway has emerged as a target for the development of new therapeutic interventions in cancers. However, the role of the Hippo-targeted

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.