Skip to Content
Merck
All Photos(7)

Key Documents

WH0064399M1

Sigma-Aldrich

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5D11, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HHIP(64399)

General description

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

Immunogen

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

Application

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

Biochem/physiol Actions

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
Wang B
Gene (2013)
Hedgehog signaling inhibition by the small molecule smoothened inhibitor GDC-0449 in the bone forming prostate cancer xenograft MDA PCa 118b.
Karlou M
Prostate (2012)
Gene expression analysis uncovers novel hedgehog interacting protein (HHIP) effects in human bronchial epithelial cells.
Zhou X
Genomics (2013)
Epigenetic regulation of human hedgehog interacting protein in glioma cell lines and primary tumor samples.
Shahi MH
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2015)
Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
Kwong L
Nature Communications (2014)

Global Trade Item Number

SKUGTIN
WH0064399M1-100UG4061832744353

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service