SAB1402233
Monoclonal Anti-HSPA4 antibody produced in mouse
clone 3A11, purified immunoglobulin, buffered aqueous solution
Synonym(s):
APG-2, HS24/P52, MGC131852, RY, hsp70, hsp70RY
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3A11, monoclonal
form
buffered aqueous solution
mol wt
antigen ~42.39 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HSPA4(3308)
Related Categories
Immunogen
HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Biochem/physiol Actions
Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Cheng-Wu Zhang et al.
Neuro-degenerative diseases, 16(5-6), 304-316 (2016-02-18)
Mutations of parkin are a prevalent genetic contributor to familial Parkinson's disease (PD). As a key regulator of protein and mitochondrial homeostasis, parkin plays a pivotal role in maintaining dopaminergic neuronal survival. However, whereas Drosophila parkin null mutants exhibit prominent
Chieh-Ting Fang et al.
Cellular and molecular life sciences : CMLS, 73(20), 3949-3960 (2016-05-04)
To establish a functional bipolar mitotic spindle, the centrosome expands and matures, acquiring enhanced activities for microtubule (MT) nucleation and assembly at the onset of mitosis. However, the regulatory mechanisms of centrosome maturation and MT assembly from the matured centrosome
Tomohiko Harada et al.
Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.], 9(1-2), 13-24 (2008-12-17)
Microarray-based comparative genomic hybridisation (CGH) has allowed high-resolution analysis of DNA copy number alterations across the entire cancer genome. Recent advances in bioinformatics tools enable us to perform a robust and highly sensitive analysis of array CGH data and facilitate
Induction of Hsp70 in tumor cells treated with inhibitors of the Hsp90 activity: A predictive marker and promising target for radiosensitization.
Kudryavtsev VA, et.al.
PLoS ONE, 12(3), 1-25 (2017)
Vladimir A Kudryavtsev et al.
PloS one, 12(3), e0173640-e0173640 (2017-03-16)
We studied a role of the inducible heat shock protein 70 (Hsp70) in cellular response to radiosensitizing treatments with inhibitors of the heat shock protein 90 (Hsp90) chaperone activity. Cell lines derived from solid tumors of different origin were treated
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service