SAB1402161

Monoclonal Anti-CSNK1E antibody produced in mouse

clone 2E1, purified immunoglobulin, buffered aqueous solution

• Synonym(s): HCKIE, MGC10398
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E1, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37 kDa
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable; proximity ligation assay: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_152221
• UniProt accession no.: P49674
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CSNK1E(1454)

Description

General description

The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Immunogen

CSNK1E (NP_689407, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKF

Biochem/physiol Actions

Casein kinase 1 ε (CSNK1E) phosphorylates proteins of the Wnt signaling cascade. It modulates tumor growth and cell division in salivary gland cancer, pancreatic and colon adenocarcinoma cells. CSNK1E phosphorylates dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32) and modulates dopamine receptor signaling. It also interacts with proteins involved in circadian rhythm.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable