Skip to Content
Merck
All Photos(3)

Key Documents

AV50670

Sigma-Aldrich

Anti-CTBP2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-C-terminal binding protein 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

106 kDa

species reactivity

human, bovine, guinea pig, rabbit, mouse, dog, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CTBP2(1488)

General description

The gene CTBP2 (C-terminal binding protein 2) encodes a member of the CtBP-family. The gene is mapped to human chromosome 21q21.3. It is found to be expressed ubiquitously, with higher expression in the heart, skeletal muscle, and pancreas.

Immunogen

Synthetic peptide directed towards the C terminal region of human CTBP2

Biochem/physiol Actions

The gene CTBP2 (C-terminal binding protein 2) encodes a protein that functions as a transcriptional co-repressor of several tumor suppressor genes resulting in enhanced cancer cell migration and invasion. Its expression is found to be upregulated in hepatocellular carcinoma (HCC). It may be a potential prognostic marker for post liver resection HCC. It is involved in several types of tumor initiation, progression and response to therapy. It is found to interact with the C-terminal region of adenovirus type 2/5 E1A protein, a region that negatively regulates tumorigenicity and the extent of oncogenic transformation.

Sequence

Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A novel C-terminal binding protein (CTBP2) is closely related to CTBP1, an adenovirus E1A-binding protein, and maps to human chromosome 21q21.3.
Katsanis N and Fisher EM
Genomics, 47, 294-299 (1998)
Xin Zheng et al.
Oncotarget, 6(6), 3752-3769 (2015-02-18)
C-terminal binding protein 2 (CtBP2) is a transcriptional co-repressor that promotes cancer cell migration and invasion by inhibiting multiple tumor suppressor genes that contribute to cell mobility and adhesion. In this investigation, we showed thatCtBP2 expression was increased significantly in
CtBP2 could promote prostate cancer cell proliferation through c-Myc signaling.
Zhang C
Gene, 546, 73-79 (2014)
Soroush G Sadeghi et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(44), 14536-14550 (2014-10-31)
In the vestibular periphery a unique postsynaptic terminal, the calyx, completely covers the basolateral walls of type I hair cells and receives input from multiple ribbon synapses. To date, the functional role of this specialized synapse remains elusive. There is

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service