Skip to Content
Merck
All Photos(1)

Key Documents

AV46228

Sigma-Aldrich

Anti-PIP3-E (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-IPCEF1, Anti-KIAA0403, Anti-Phosphoinositide-binding protein PIP3-E, Anti-RP3-402L9.2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PIP3-E(26034)

Immunogen

Synthetic peptide directed towards the middle region of human PIP3-E

Application

Anti-PIP3-E (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Biochem/physiol Actions

PIP3-E (Phosphoinositide-binding protein PIP3-E) also referred to as Interactor protein for cytohesin exchange factors 1 (IPCEF1) is a protein that binds to cytohesin 2 and augments its activity in cultured cells. This results in the nerve injury-induced membrane receptor trafficking in the dorsal root ganglions (DRGs) of adult rats under neuropathic pain conditions. Further, IPCEF1 produces a single protein that plays a crucial role in HGF-induced Arf6 activation and migration in response to HGF treatment.

Sequence

Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xiang Zhang et al.
Journal of experimental & clinical cancer research : CR, 39(1), 190-190 (2020-09-18)
Insulin-like growth factor 2 (IGF2) messenger RNA binding protein 3 (IMP3) has been testified to be overexpressed in prostate cancer and strongly related to patients' poor prognosis. However, the functions of IMP3 and the underlying mechanisms in prostate cancer still
Myriam A Attar et al.
Experimental cell research, 318(3), 228-237 (2011-11-17)
Epithelial cells are largely immotile under normal circumstances, but become motile during development, repair of tissue damage and during cancer metastasis. Numerous growth factors act to initiate epithelial cell movements. Hepatocyte growth factor (HGF) induces many epithelial cell lines to
Xiaowei Guan et al.
Naunyn-Schmiedeberg's archives of pharmacology, 380(5), 459-463 (2009-09-17)
Interaction protein for cytohesin exchange factors 1 (IPCEF1) is a recently identified protein that binds to cytohesin 2 and might participate in membrane receptor trafficking by enhancing the activity of cytohesin 2 in cultured cells. However, whether IPCEF1 is involved

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service