HPA010775
Anti-NECTIN4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
LNIR antibody produced in rabbit, PRR4, PVRL4
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PVRL4(81607)
Related Categories
General description
PVRL4 (poliovirus receptor-related 4) belongs to a family of cell adhesion molecules called nectins, which in turn belong to immunoglobulin superfamily. It has a cytoplasmic tail domain, a single transmembrane domain, and three immunoglobulin-like domains in the extracellular region. Due to alternative splicing PVRL4 has two isoforms, with one lacking amino acids 412-436. In humans, this gene is localized to chromosome 1q23. Unlike other members of nectin family, PVRL4, also called nectin-4, is expressed mainly in embryo and placenta.
Immunogen
nectin cell adhesion molecule 4 recombinant protein epitope signature tag (PrEST)
Application
Anti-PVRL4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
PVRL4 (poliovirus receptor-related 4) either forms a homodimer or a heterodimer with nectin-1, to facilitate cell-cell adhesion. It also aids the entry and lateral spread of measles virus, in primary epithelia lining the human airway. It is highly expressed in a variety of cancers such as, breast, lung and ovarian cancers. Its specificity for measles virus and expression in cancer cells makes it a potential oncolysis tool. Mutations in PVRL4 gene is associated with ectodermal dysplasia-syndactyly syndrome (EDSS), which is characterized by abnormalities in hair and tooth, alopecia, and cutaneous syndactyly. In keratinocytes of EDSS patients, mutated PVRL4 is incapable of forming a dimer with nectin-1. It is highly expressed in non-small cell lung cancers (NSCLC), and is associated with poor prognosis. Therefore, it might be involved in tumorigenesis of lung cancer, and has potential as a both marker and a therapeutic target for NSCLC.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST72029
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rose Richardson et al.
PLoS genetics, 13(6), e1006828-e1006828 (2017-06-13)
Cleft palate is a common congenital disorder that affects up to 1 in 2500 live births and results in considerable morbidity to affected individuals and their families. The aetiology of cleft palate is complex with both genetic and environmental factors
Abolfazl Razzaghdoust et al.
BioMed research international, 2021, 2670573-2670573 (2021-01-26)
Antibody-drug conjugate therapy has attracted considerable attention in recent years. Since the selection of appropriate targets is a critical aspect of antibody-drug conjugate research and development, a big data research for discovery of candidate targets per tumor type is outstanding
Ingrid V Allen et al.
mSphere, 3(3) (2018-05-11)
Characterization of human measles cases is essential in order to better assess the data generated in model systems of morbillivirus infection. To this end, we collected formalin-fixed tissue samples from 23 natural measles cases from different areas in the world
Xiang Xu et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 68(Pt 8), 942-945 (2012-08-08)
Nectin-4 belongs to a family of immunoglobulin-like cell adhesion molecules and is highly expressed in cancer cells. Recently, nectin-4 was found to be a receptor of measles virus and the IgV domain sustains strong binding to measles virus H protein.
Hirosha Geekiyanage et al.
Molecular oncology, 10(9), 1387-1403 (2016-08-11)
Oncolytic measles virus strains are currently being evaluated in several clinical trials, as a promising novel oncolytic platform. Poliovirus receptor-related 4 (PVRL4) was recently identified as a potent measles virus (MV) receptor; however, its regulation is not yet understood. Increased
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service