Skip to Content
Merck
All Photos(2)

Key Documents

AV41699

Sigma-Aldrich

Anti-PKLR antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-PK1, Anti-PKL, Anti-Pyruvate kinase, liver and RBC, Anti-RPK

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

58 kDa

species reactivity

human, rat, pig, rabbit, bovine, dog, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PKLR(5313)

Related Categories

General description

Pyruvate kinase (PKLR) is a liver/erythrocyte-specific enzyme that exists as a tetramer. It comprises structural and functional domains namely N. A and C domains. The C domain is erythrocyte-specific and the A domain is active site residues. The PKLR gene is mapped to human chromosome 1q22.

Immunogen

Synthetic peptide directed towards the N terminal region of human PKLR

Application

Anti-PKLR antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Pyruvate kinase (PKLR) is needed for energy generation in erythrocytes. Deficiency of PKLR in mice reduces the risk of blood-stage malarial parasite Plasmodium chabaudi induced infection.

Sequence

Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Daiki Nakatsu et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(10), E1067-E1076 (2015-02-26)
Increase in the concentration of plasma L-cysteine is closely associated with defective insulin secretion from pancreatic β-cells, which results in type 2 diabetes (T2D). In this study, we investigated the effects of prolonged L-cysteine treatment on glucose-stimulated insulin secretion (GSIS)
Hua-Lin Zhou et al.
Nature, 565(7737), 96-100 (2018-11-30)
Endothelial nitric oxide synthase (eNOS) is protective against kidney injury, but the molecular mechanisms of this protection are poorly understood1,2. Nitric oxide-based cellular signalling is generally mediated by protein S-nitrosylation, the oxidative modification of Cys residues to form S-nitrosothiols (SNOs).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service