SAB5702005

Anti-Bak Antibody, clone 7Q3T8, Rabbit Monoclonal

• Synonym(s): BAK1,BAK,BAK-LIKE,BCL2L7
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 7Q3T8, monoclonal
• form: liquid
• mol wt: 25 kDa
• species reactivity: mouse, mouse
• concentration: 0.089 mg/mL
• technique(s): immunohistochemistry: 1:50 - 1:100; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: RQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIG
• UniProt accession no.: Q16611
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BAK1(578)

Description

General description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 11-82 of human Bak (NP_001179.1).

Application

WB, IHC

Safety Information

• Pictograms: GHS07,GHS09
• Signal Word: Warning
• Hazard Statements: H317 - H411
• Precautionary Statements: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3