SAB1405736

Anti-E2F2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): E2F-2
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~9.24 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC007609
• UniProt accession no.: Q14209
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... E2F2(1870)

Description

General description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. (provided by RefSeq)

Immunogen

E2F2 (AAH07609, 1 a.a. ~ 83 a.a) full-length human protein.

Sequence
MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable