SAB1401793

Monoclonal Anti-FKBP10 antibody produced in mouse

clone 1C6, ascites fluid

• Synonym(s): FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1C6, monoclonal
• species reactivity: human
• technique(s): capture ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgG2aκ
• NCBI accession no.: NM_021939
• UniProt accession no.: Q96AY3
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... FKBP10(60681)

Description

General description

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. (provided by RefSeq)

Immunogen

FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Clear solution

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable