SAB1400310

Anti-SSPN antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Synonym(s): Anti-KRAG, Anti-SPN1, Anti-SPN2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• UniProt accession no.: Q14714
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SSPN(8082)

Description

General description

This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. (provided by RefSeq)

Immunogen

SSPN (NP_005077.2, 1 a.a. ~ 243 a.a) full-length human protein.

Sequence
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable