Skip to Content
Merck
All Photos(11)

Key Documents

HPA008422

Sigma-Aldrich

Anti-NFKB2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DNA-binding factor KBF2, Anti-H2TF1, Anti-Lymphocyte translocation chromosome 10, Anti-Lyt10, Anti-Nuclear factor NF-kappa-B p100 subunit, Anti-Oncogene Lyt-10

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
RNAi knockdown
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NFKB2(4791)

General description

Nuclear factor NF-κ-B p100 subunit (NFKB2) is a transcription factor which belongs to the NF-kappa B/Rel family of proteins.

Immunogen

Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Nuclear factor NF-κ-B p100 subunit (NFKB2) is at the endpoint of many of signal transduction pathways which are initiated by stimuli such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. It forms a homo- or heterodimeric complex with proteins. These complexes bind at κ-B sites in the DNA of their target genes. NFKB2 complexes are present in the cytoplasm in an inactive state bound to the NF-κ-B inhibitors. For the activation of NFKB2, I-κ-B (inhibitor) is phosphorylated by I-κ-B kinases (IKKs) and degraded. Thus the active NF-κ-B complex is free from the inhibitor and can translocate to the nucleus. NFKB2 plays an important role in the cytoplasmic retention of attached NFKB2 proteins by p100 and the generation of p52 by cotranslational processing. It also regulates the circadian clock by repressing the transcriptional activator activity of the complex formed by aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL) with other proteins.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86729

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kivia A P de Oliveira et al.
Genome medicine, 8(1), 28-28 (2016-03-19)
NF-κB is widely involved in lymphoid malignancies; however, the functional roles and specific transcriptomes of NF-κB dimers with distinct subunit compositions have been unclear. Using combined ChIP-sequencing and microarray analyses, we determined the cistromes and target gene signatures of canonical
P Dobrzanski et al.
The EMBO journal, 13(19), 4608-4616 (1994-10-03)
The Rel-NF-kappa B family of transcription factors plays a crucial role in the regulation of genes involved in inflammatory and immune responses. We demonstrate that in vivo, in contrast to the other members of the family, RelB associates efficiently only
M Heusch et al.
Oncogene, 18(46), 6201-6208 (1999-12-22)
nfkb2 encodes two members of the NF-kappa B/Rel family of proteins: p52 and p100. The p100 polypeptide has been proposed to serve as a precursor of p52, which corresponds to the N-terminal half of p100. While p52 functions as a
Haihui Lu et al.
Nature cell biology, 16(11), 1105-1117 (2014-10-01)
The cell-biological program termed the epithelial-mesenchymal transition (EMT) confers on cancer cells mesenchymal traits and an ability to enter the cancer stem cell (CSC) state. However, the interactions between CSCs and their surrounding microenvironment are poorly understood. Here we show

Global Trade Item Number

SKUGTIN
HPA008422-100UL4061837124662
HPA008422-25UL4061842796649

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service