SAB5702227

Anti-ABL2 Antibody, clone 2L9C6, Rabbit Monoclonal

• Synonym(s): ABLL, ARG
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 2L9C6, monoclonal
• form: liquid
• mol wt: 128 kDa
• species reactivity: rat, human, rat
• concentration: 0.47 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
• UniProt accession no.: P42684
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ABL2(27)

Description

General description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1