AV36568
Anti-ANXA1 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Annexin A1
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
UNSPSC Code:
12352203
clone:
polyclonal
application:
IHC
WB
WB
species reactivity:
human
technique(s):
immunohistochemistry: suitable
western blot: suitable
western blot: suitable
citations:
1
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
38 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ANXA1(301)
General description
Annexin A1, ANXA1, also known as lipocortin I, is an anti-inflammatory protein originally identified as a phospholipase A2 (PLA2)-inhibitory protein. Its expression is induced by glucocorticoids in immune cells where it has been shown to promote cellular apoptosis. ANXA1 is a 40 kDa protein that binds to the cytosolic side of the cellular membrane in a Ca-dependent manner.
Immunogen
Synthetic peptide directed towards the N terminal region of human ANXA1
Biochem/physiol Actions
ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Sequence
Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Luca Parente et al.
Inflammation research : official journal of the European Histamine Research Society ... [et al.], 53(4), 125-132 (2004-04-03)
Annexin 1 (ANXA1) is the first characterized member of the annexin family of proteins able to bind (i.e. to annex) to cellular membranes in a calcium-dependent manner. ANXA1 may be induced by glucocorticoids in inflammatory cells and shares with these
Ming-Jen Sheu et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 35(8), 7755-7763 (2014-05-09)
Neoadjuvant concurrent chemoradiation therapy (CCRT) is an increasingly common therapeutic strategy for rectal cancer. Clinically, it remains a major challenge to predict therapeutic response and patient outcomes after CCRT. Annexin I (ANXA1), encoded by ANXA1, is a Ca(2+)/phospholipid-binding protein that
Maxime S Heroux et al.
Physiological genomics, 46(13), 467-481 (2014-05-08)
Cancer is a complex disease; glioblastoma (GBM) is no exception. Short survival, poor prognosis, and very limited treatment options make it imperative to unravel the disease pathophysiology. The critically important identification of proteins that mediate various cellular events during disease
Xiaojie Liu et al.
Brain research bulletin, 106, 9-16 (2014-04-29)
N-methyl-D-aspartate receptor (NMDAR) and metabotropic glutamate receptor 5 (mGluR5) play an important role in nociceptive processing and central sensitization. Our previous study showed that tyrosine phosphorylation of NMDAR subunit 2B (NR2B) at Tyr1472 in spinal dorsal horn contributes to the
María Florencia Ogara et al.
Biochimica et biophysica acta, 1843(7), 1309-1324 (2014-04-08)
DNA damage, which perturbs genomic stability, has been linked to cognitive decline in the aging human brain, and mutations in DNA repair genes have neurological implications. Several studies have suggested that DNA damage is also increased in brain disorders such
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service