171596

β-Amyloid Peptide

≥80% (HPLC), lyophilized, 1-42, rat

• Synonym(s): β-Amyloid Peptide (1-42), Rat, DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Empirical Formula (Hill Notation): C₁₉₉H₃₀₇N₅₃O₅₉S
• CAS Number: 107761-42-2
• Molecular Weight: 4417.95
• MDL number: MFCD00163049
• UNSPSC Code: 12352202
• NACRES: NA.26

Properties

• product name: β-Amyloid Peptide (1-42), Rat,
• description: Predominant peptide found in the brain of patients with Alzheimer′s Disease and Down′s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
• Quality Level: 100
• Assay: ≥80% (HPLC)
• form: lyophilized
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze; desiccated (hygroscopic)
• solubility: 5% acetic acid: 1 mg/mL
• shipped in: ambient
• storage temp.: −20°C

Description

General description

β-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer′s diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.

Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

Warning

Toxicity: Standard Handling (A)

Sequence

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Other Notes

Paradis, E., et al. 1996. J. Neurosci.16, 7533.
Roher, A.E., et al. 1996. J. Biol. Chem.271, 20631.
Soto, C., and Castano, E.M. 1996. Biochem. J.314, 701.
Murrell, J., et al. 1991. Science254, 97.
Goldgaber, D., et al. 1987. Science235, 877.
Kang, J., et al. 1987. Nature 325, 733.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable