Skip to Content
Merck
All Photos(3)

Key Documents

WH0005223M1

Sigma-Aldrich

Monoclonal Anti-PGAM1 antibody produced in mouse

clone 2G1-A6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-PGAMA, Anti-phosphoglycerate mutase 1 (brain)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G1-A6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PGAM1(5223)

General description

Phosphoglycerate mutase 1 (PGAM1) is an important glycolytic enzyme. This gene is located on human chromosome 10q24.

Immunogen

PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Application

Monoclonal Anti-PGAM1 antibody has been used in western blotting.

Biochem/physiol Actions

Phosphoglycerate mutase 1 (PGAM1) participates in glycolysis, pentose phosphate pathway and serine biosynthesis in cancer cells. It helps to convert 3-phosphoglycerate (3-PG) into 2-PG in glycolysis. PGAM1 is essential to support glycolysis for normal cell activities.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Identification of proteins with different abundance associated with cell migration and proliferation in leiomyoma interstitial fluid by proteomics
Ura B, et al.
Oncology Letters, 13(5), 3912-3920 (2017)
Bisphosphoglycerate mutase controls serine pathway flux via 3-phosphoglycerate
Oslund RC, et al.
Nature Chemical Biology, 13(10), 1081-1087 (2017)
CHUK, a conserved helix-loop-helix ubiquitous kinase, maps to human chromosome 10 and mouse chromosome 19
Mock BA, et al.
Genomics, 27(2), 348-351 (1995)
Phosphoglycerate mutase 1 regulates dNTP pool and promotes homologous recombination repair in cancer cells
Qu J, et al.
The Journal of Cell Biology, 216(2), 409-424 (2017)
Blendi Ura et al.
Oncology letters, 13(5), 3912-3920 (2017-05-20)
Uterine leiomyoma is the most common female reproductive tract benign tumor. Little is known about protein composition and changes in the leiomyoma interstitial fluid (IF). The present study focused on changes in protein abundance in the IF of leiomyoma. Leiomyoma

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service