Skip to Content
Merck
All Photos(3)

Key Documents

SAB2107063

Sigma-Aldrich

Anti-GFAP antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

rat, mouse, human, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GFAP(2670)
mouse ... Gfap(14580)

Immunogen

Synthetic peptide directed towards the N terminal of human GFAP

Biochem/physiol Actions

GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

Sequence

Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Aswin Hari et al.
Scientific reports, 7(1), 9836-9836 (2017-08-31)
Enhanced postnatal care (EPC) increases resilience to adversity in adulthood. Since microglia participate in shaping neural circuits, we asked how ablation of an inflammation-suppressing factor IRF2BP2 (Interferon Regulatory Factor 2 Binding Protein 2) in microglia would affect the responses to
Matteo Bergami et al.
The Journal of cell biology, 183(2), 213-221 (2008-10-15)
Activity-dependent secretion of brain-derived neurotrophic factor (BDNF) is thought to enhance synaptic plasticity, but the mechanisms controlling extracellular availability and clearance of secreted BDNF are poorly understood. We show that BDNF is secreted in its precursor form (pro-BDNF) and is
Weigang Cui et al.
Molecular medicine reports, 22(2), 739-750 (2020-05-30)
Cognitive impairment and neuro‑inflammatory responses are the distinctive characteristics of Alzheimer's disease (AD). Tormentic acid (TA) is one of the major active components of Potentilla chinensis and has been demonstrated to have anti‑inflammatory properties. However, the potential effects of TA on
Cecilia Bull et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 39(12), 2835-2845 (2014-06-07)
Our understanding of the active role that astrocytes play in modulating neuronal function and behavior is rapidly expanding, but little is known about the role that astrocytes may play in drug-seeking behavior for commonly abused substances. Given that the nucleus
Margaret R Lentz et al.
PloS one, 9(8), e105752-e105752 (2014-08-22)
There are currently no widely accepted neuro-HIV small animal models. We wanted to validate the HIV-1 Transgenic rat (Tg) as an appropriate neuro-HIV model and then establish in vivo imaging biomarkers of neuropathology, within this model, using MR structural and

Global Trade Item Number

SKUGTIN
SAB2107063-50UG
SAB2107063-100UL4061836126728

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service