AV42662

Anti-EDG8 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Edg-8, Anti-Endothelial differentiation, sphingolipid G-protein-coupled receptor, 8, Anti-S1P5, Anti-S1PR5, Anti-SPPR-1, Anti-SPPR-2
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 44 kDa
• species reactivity: mouse, dog, human, pig, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_110387
• UniProt accession no.: Q9H228
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EDG8(53637)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human EDG8

Biochem/physiol Actions

EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Sequence

Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable