AV32598
Anti-GTF2H4 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-General transcription factor IIH, polypeptide 4, 52 kDa, Anti-TFIIH
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
human, mouse, guinea pig, dog, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GTF2H4(2968)
General description
GTF2H4 is a 52kDa transcription factor. Mutations in this gene have been linked to the risk of multiple sclerosis.
Rabbit Anti-GTF2H4 antibody recognizes human, mouse, rat, bovine, and pig GTF2H4.
Rabbit Anti-GTF2H4 antibody recognizes human, mouse, rat, bovine, and pig GTF2H4.
Immunogen
Synthetic peptide directed towards the N terminal region of human GTF2H4
Application
Rabbit Anti-GTF2H4 antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Sequence
Synthetic peptide located within the following region: ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Farren B S Briggs et al.
American journal of epidemiology, 172(2), 217-224 (2010-06-05)
Multiple sclerosis (MS) is a complex autoimmune disease of the central nervous system with a prominent genetic component. The primary genetic risk factor is the human leukocyte antigen (HLA)-DRB1*1501 allele; however, much of the remaining genetic contribution to MS has
Haizhong Feng et al.
The Journal of clinical investigation, 124(9), 3741-3756 (2014-07-26)
Aberrant activation of EGFR in human cancers promotes tumorigenesis through stimulation of AKT signaling. Here, we determined that the discoidina neuropilin-like membrane protein DCBLD2 is upregulated in clinical specimens of glioblastomas and head and neck cancers (HNCs) and is required
Vicky García-Hernández et al.
Journal of cellular physiology, 230(1), 105-115 (2014-06-10)
Epidermal Growth Factor (EGF) is a key regulator of epithelial paracellular permeability, a property that depends on tight junctions (TJ) and can be evaluated through the measurement of the transepithelial electrical resistance (TER). EGF increases the TER of MDCK monolayers
Yu Kamishibahara et al.
Neuroscience letters, 579, 58-63 (2014-07-20)
Rho kinase (ROCK) is one of the major downstream mediators of Rho. Rho plays crucial regulatory roles in the cellular proliferation and differentiation. Because a ROCK inhibitor, Y-27632, is known to inhibit the dissociation-induced cell death in human embryonic stem
Ahmed Menaouar et al.
International journal of cardiology, 175(1), 38-49 (2014-05-24)
Oxytocin (OT) and functional OT receptor (OTR) are expressed in the heart and are involved in blood pressure regulation and cardioprotection. Cardiac OTR signaling is associated with atrial natriuretic peptide (ANP) and nitric oxide (NO) release. During the synthesis of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service