Skip to Content
Merck
All Photos(2)

Documents

WH0003559M4

Sigma-Aldrich

Monoclonal Anti-IL2RA antibody produced in mouse

clone 1D6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CD25, Anti-IL2R, Anti-TCGFR, Anti-interleukin 2 receptor, alpha

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL2RA(3559)

General description

Interleukin 2 receptor alpha (IL2RA) is a part of the IL-2 receptor. It is expressed on regulatory T cells. IL2RA gene is mapped to human chromosome 10p15.1.

Immunogen

IL2RA (NP_000408, 22 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL*

Biochem/physiol Actions

Interleukin 2 receptor alpha (IL2RA) combines with a tri-molecular complex to exhibit a high-affinity receptor for IL-2. Activated immune cells release IL2RA and produce soluble (sIL2RA). Higher circulating levels of sIL2RA leads to multiple sclerosis (MS) disease activities. IL2RA initiates T cell proliferation in an autocrine and paracrine manner. Elevated levels of IL-2R is detected in coronavirus disease 2019 (COVID-19)infected patients.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Max Mimpen et al.
Journal of neuroimmunology, 353, 577499-577499 (2021-02-03)
NK/T-cell ratios predict disease activity in relapsing remitting multiple sclerosis (RRMS). We investigated in 50 RRMS patients whether interleukin-2 receptor alpha-chain (IL-2Rα) expression and shedding associates with NK/T-cell balance, as suggested by daclizumab-trials in RRMS. A subsample (N = 31) was genotyped
Víctor J Costela-Ruiz et al.
Cytokine & growth factor reviews, 54, 62-75 (2020-06-10)
COVID-19 disease, caused by infection with SARS-CoV-2, is related to a series of physiopathological mechanisms that mobilize a wide variety of biomolecules, mainly immunological in nature. In the most severe cases, the prognosis can be markedly worsened by the hyperproduction
Daniela B Engler et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(32), 11810-11815 (2014-07-31)
The prevalence of allergic asthma and other atopic diseases has reached epidemic proportions in large parts of the developed world. The gradual loss of the human indigenous microbiota has been held responsible for this trend. The bacterial pathogen Helicobacter pylori
Hong Guo et al.
Journal of leukocyte biology, 96(3), 419-426 (2014-05-29)
C/EBPα is expressed preferentially in myeloid compared with lymphoid or erythroid cells and directs myeloid lineage specification. C/EBPα is also expressed at lower levels in HSCs and in several nonhematopoietic tissues. The Cebpa gene has a conserved, 450-bp segment at
Fanhang Meng et al.
Inflammation, 37(5), 1799-1805 (2014-05-03)
Myeloid-derived suppressor cells (MDSCs) are negative regulators of the immune response and are in part responsible for the inhibition of the T cell-mediated immune response. A recent paper indicated that MDSCs were involved in prolonged allograft survival in animal models

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service