Skip to Content
Merck
All Photos(3)

Key Documents

AV38413

Sigma-Aldrich

Anti-NFKB1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (p105)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

105 kDa

species reactivity

dog, guinea pig, horse, mouse, rat, bovine, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NFKB1(4790)

Immunogen

Synthetic peptide directed towards the N terminal region of human NFKB1

Biochem/physiol Actions

NFKB1 is a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B

Sequence

Synthetic peptide located within the following region: PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Eduardo Anitua et al.
Neurobiology of aging, 35(7), 1582-1595 (2014-02-15)
Impaired growth factor function is thought to drive many of the alterations observed in Alzheimer's disease (AD) patients. Endogenous regenerative technology, PRGF (plasma rich in growth factor)-Endoret, is designed for the delivery of a complex pool of patient's own active
Y Yu et al.
British journal of cancer, 111(3), 515-524 (2014-06-13)
Ovarian cancer has the highest mortality rate of the gynaecological cancers. Although cisplatin (CDDP) is an effective treatment for ovarian cancer, recurrence is frequent and leads to death. The objective was to explore the role and possible mechanisms of platelet-activating
Yu-Qin Shi et al.
Toxicology and industrial health, 30(10), 901-909 (2012-11-20)
Formaldehyde is a major industrial chemical and has been extensively used in the manufacture of synthetic resins and chemicals. Numerous studies indicate that formaldehyde can induce various genotoxic effects in vitro and in vivo. A recent study indicated that formaldehyde
Tong Yuan et al.
The Journal of surgical research, 192(1), 150-162 (2014-06-24)
Lidocaine has been used as a local anesthetic with anti-inflammatory properties, but its effects on neuroinflammation have not been well defined. In the present study, we investigated the prophylactic effects of lidocaine on lipopolysaccharide (LPS)-activated microglia and explored the underlying
Egle Cekanaviciute et al.
Journal of immunology (Baltimore, Md. : 1950), 193(1), 139-149 (2014-05-27)
The balance between controlling infection and limiting inflammation is particularly precarious in the brain because of its unique vulnerability to the toxic effects of inflammation. Astrocytes have been implicated as key regulators of neuroinflammation in CNS infections, including infection with

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service