Skip to Content
Merck
All Photos(1)

Key Documents

AV36582

Sigma-Aldrich

Anti-ANXA6 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Annexin A6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ANXA6(309)

Immunogen

Synthetic peptide directed towards the C terminal region of human Anxa6

Biochem/physiol Actions

ANXA6 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It inhibits the activity of cytoplasmic phospholipase A2 and prevenst the transport of caveolin-1 from the Golgi complex. ANXA6 has been reported to regulate mitochondrial homeostasis by inhibiting Drp1 and blocking mitochondrial fission.

Sequence

Synthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Marcin Chlystun et al.
PloS one, 8(1), e53774-e53774 (2013-01-24)
Mitochondrial homeostasis is critical in meeting cellular energy demands, shaping calcium signals and determining susceptibility to apoptosis. Here we report a role for anxA6 in the regulation of mitochondrial morphogenesis, and show that in cells lacking anxA6 mitochondria are fragmented
Laia Cubells et al.
The Journal of biological chemistry, 283(15), 10174-10183 (2008-02-05)
The molecular mechanisms regulating the exit of caveolin from the Golgi complex are not fully understood. Cholesterol and sphingolipid availability affects Golgi vesiculation events and involves the activity of cytoplasmic phospholipase A(2) (cPLA(2)). We recently demonstrated that high expression levels
Volker Gerke et al.
Nature reviews. Molecular cell biology, 6(6), 449-461 (2005-06-02)
Eukaryotic cells contain various Ca(2+)-effector proteins that mediate cellular responses to changes in intracellular Ca(2+) levels. A unique class of these proteins - annexins - can bind to certain membrane phospholipids in a Ca(2+)-dependent manner, providing a link between Ca(2+)
Young-Rak Cho et al.
Oncology reports, 32(4), 1531-1536 (2014-08-12)
Broussonetia kazinoki (BK) has been used as a traditional medicine to improve vision, as well as for inflammatory and infectious diseases. In the present study, we investigated the effects and molecular mechanism of the ethanolic extract of BK on cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service