Skip to Content
Merck
All Photos(1)

Key Documents

HPA014395

Sigma-Aldrich

Anti-GRIK2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-EAA4, Anti-Excitatory amino acid receptor 4, Anti-GluR-6, Anti-GluR6, Anti-Glutamate receptor 6, Anti-Glutamate receptor, ionotropic kainate 2 precursor

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GRIK2(2898)

Related Categories

General description

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLuK1 to GLuK5. GRIK2 is also called GluK2 or GluR6. This protein has three different isoforms, differing in their C-termini. The longest isoform called GluK2a is composed of 908 amino acids. This gene is localized to human chromosome 6, spans ~670kb, and has 17 exons. The corresponding mRNA is expressed in dentate gyrus, cornu ammonis 3 (CA3) in the pyramidal neurons, cell layer of cerebellar granule, and neocortical regions of the brain.

Immunogen

Glutamate receptor, ionotropic kainate 2 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a receptor which regulates the neurotransmission through excitatory neurotransmitters in brain. Mutation M867I, which causes replacement of methionine-to-isoleucine at position 867, is associated with autism. Studies show that polymorphisms in this gene are linked to various mental disorders such as, schizophrenia, early-onset Huntington′s disease, and autosomal recessive mental retardation. Variants of this gene are also the causatives of obsessive-compulsive disorder (OCD). The tyrosine residue of GRIK2 is phosphorylated by Src, post brain ischemia. This phosphorylation causes an increase in Ca2+ influx and cell currents. It also activates downstream pro-apoptotic signaling, and thus, might have a role in the pathology of ischemic stroke. The ACAG haplotype in GRIK2 gene is linked with somatic anxiety.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72944

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qiu-Ju Zhu et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(38), 13990-13995 (2014-09-10)
Although kainate receptors play important roles in ischemic stroke, the molecular mechanisms underlying postischemic regulation of kainate receptors remain unclear. In this study we demonstrate that Src family kinases contribute to the potentiation of kainate receptor function. Brain ischemia and
Yan Han et al.
Biochemistry, 49(43), 9207-9216 (2010-09-25)
GluK2 is a kainate receptor subunit that is alternatively spliced at the C-terminus. Previous studies implicated GluK2 in autism. In particular, the methionine-to-isoleucine replacement at amino acid residue 867 (M867I) that can only occur in the longest isoform of the
Aline S Sampaio et al.
CNS neuroscience & therapeutics, 17(3), 141-147 (2010-04-08)
Several studies support a genetic influence on obsessive-compulsive disorder (OCD) etiology. The role of glutamate as an important neurotransmitter affecting OCD pathophysiology has been supported by neuroimaging, animal model, medication, and initial candidate gene studies. Genes involved in glutamatergic pathways
Woojae Myung et al.
Psychiatry research, 198(3), 400-406 (2012-03-21)
The heritability of some individual depressive symptoms has been well established. However, the causal genes related to individual depressive symptoms and genetic effects on the courses of individual depressive symptoms are still unclear. We examined these issues in 241 Korean
Ji-Hyun Lee et al.
Biochemical and biophysical research communications, 424(3), 404-408 (2012-07-10)
Huntington's disease is a neurodegenerative disorder caused by an expanded CAG trinucleotide repeat whose length is the major determinant of age at onset but remaining variation appears to be due in part to the effect of genetic modifiers. GRIK2, which

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service