AMAB91038
Anti-S100B Antibody
Prestige Antibodies® Powered by Atlas Antibodies, mouse monoclonal, CL2720
Synonym(s):
S100beta
Sign Into View Organizational & Contract Pricing
All Photos(8)
About This Item
Recommended Products
product name
Monoclonal Anti-S100B antibody produced in mouse, Prestige Antibodies® Powered by Atlas Antibodies, clone CL2720, purified immunoglobulin, buffered aqueous glycerol solution
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
CL2720, monoclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 1 μg/mL
immunohistochemistry: 1:500- 1:1000
isotype
IgG1
immunogen sequence
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
UniProt accession no.
application(s)
research pathology
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... S100B(6285)
General description
The gene S-100 β subunit (S100B) is a 21kDa acidic protein. It is encoded by the gene mapped to human chromosome 21q22.3. The gene codes for a calcium-binding protein and is a member of S100 family of calcium-binding proteins. The encoded protein is produced predominantly by astrocytes. S100B is a homodimer with two β subunits.
Immunogen
S100 calcium binding protein B
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Monoclonal Anti-S100B antibody produced in mouse has been used in immunocytochemistry and immunofluorescence studies.
Monoclonal Anti-S100B antibody produced in mouse has been used in immunocytochemistry and immunofluorescence studies.
Biochem/physiol Actions
S-100 β subunit (S100B) exerts paracrine and autocrine effects on neurons and glia. At nanomolar concentrations, the encoded protein promotes neurite outgrowth and increases survival of neurons during development. S100B serves as a marker of melanocyte cytotoxicity. In addition, it also acts as a serum marker in endocrine resistant breast cancer and Nonsegmental Vitiligo. Decreased expression of S100B has been observed in chronic liver disease patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Decreased S100B expression in chronic liver diseases.
Baik S J, et al.
The Korean Journal of Internal Medicine, 32(2), 269?276-269?276 (2017)
S100β as a serum marker in endocrine resistant breast cancer.
Charmsaz S, et al.
BMC Medicine, 51(1), 79-79 (2017)
Rapid prenatal diagnosis of trisomy 21 by real-time quantitative polymerase chain reaction with amplification of small tandem repeats and S100B in chromosome 21.
Yang Y H, et al.
Yonsei Medical Journal, 46(6), 193-197 (2005)
Salil Sharma et al.
Scientific reports, 8(1), 9251-9251 (2018-06-20)
MicroRNAs (miRs) are 18~23 nucleotides long non-coding RNAs that regulate gene expression. To explore whether miR alterations in tauopathy contribute to pathological conditions, we first determined which hippocampal miRs are altered at the presymptomatic and symptomatic stages of tauopathy using
Reactive Astrocytes Promote ALS-like Degeneration and Intracellular Protein Aggregation in Human Motor Neurons by Disrupting Autophagy through TGF-β1.
Tripathi P, et al.
Stem Cell Reports, 9(2), 667-680 (2017)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service