SAB1412344

ANTI-FOXC2 antibody produced in mouse

clone 3E6, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FKHL14, FOXC2, LD, MFH-1, MFH1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E6, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.74 kDa
• species reactivity: human,
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_005251
• UniProt accession no.: Q99958
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXC2(2303)

Description

General description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogen

FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable