HPA014740

Anti-KCNC4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-KSHIIIC, Anti-Potassium voltage-gated channel subfamily C member 4, Anti-Voltage-gated potassium channel subunit Kv34
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA014740
• NACRES: NA.43

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL
• immunogen sequence: ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
• UniProt accession no.: Q03721
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KCNC4(3749)

Description

General description

KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4) is an A-type K⁺ channel, and is also called K_v3.4. Its inactivation gate is made by the first 28 amino acids present in the N-terminal. This inactivation sequence also contains four predicted protein kinase C (PKC) phosphorylation sites. It is expressed in muscle, spinal cord, dorsal root ganglia, mossy fiber neurons and Purkinje neurons.

Immunogen

Potassium voltage-gated channel subfamily C member 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4) is suppressed by protein kinase C by N-type inactivation, in dorsal root ganglia neurons. This results in regulation of the duration of action potential, as well as the rate of repolarization. Any aberration leads to loss of homeostasis, which is seen in chronic pain conditions post spinal cord injury. Ionizing radiation leads to the activation of this channel, which results in cell cycle arrest in G2/M phase, as seen in irradiated leukemia cells. This channel is up-regulated in head and neck squamous cell carcinomas, where it facilitates tumorigenesis and malignancy. In vitro studies show that under the influence of estrogen, KCNC4 regulates the development and remodeling of arteries in human uterus, during pregnancy. It is up-regulated in early stages of Alzheimer′s disease (AD), and is found highly abundant at later stages of the disease, in neurodegenerative regions.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73041

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves