WH0009223M3

Monoclonal Anti-MAGI1 antibody produced in mouse

clone 7B4, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-AIP3, Anti-BAIAP1, Anti-BAP1, Anti-MAGI1, Anti-TNRC19, Anti-WWP3, Anti-membrane associated guanylate kinase, WW and PDZ domain containing 1
• Numer MDL: MFCD04040441
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 7B4, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: mouse, human, rat
• metody: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: NM_004742
• numer dostępu UniProt: Q96QZ7
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MAGI1(9223)

Opis

Immunogen

MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN

Zastosowanie

Monoclonal Anti-MAGI1 antibody produced in mouse has been used for Western Blotting.

Działania biochem./fizjol.

Membrane associated guanylate kinase, WW and PDZ domain containing 1 (MAGI1) acts as a scaffolding protein. It takes part in tight junction formation and binds to β-catenin to suppress the Wnt signaling pathway. The gene encoding it has been linked with schizophrenia and the protein is downregulated in hepatocellular carcinoma.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)