Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Kluczowe dokumenty

AV31375

Sigma-Aldrich

Anti-EN2 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-AUTS1, Anti-AUTS10, Anti-Engrailed homeobox 2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Numer MDL:
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

34 kDa

reaktywność gatunkowa

dog, mouse, guinea pig, horse, human, rat

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... EN2(2020)

Opis ogólny

Engrailed homeodomain-containing transcription factors play crucial roles in brain development across many species, including the determination of the hindbrain/midbrain border, cerebellar patterning and aiding in neuronal axon guidance. Engrailed-2 (En-2) gene is expressed across the mesencephalon/metencephalon (mes/met) boundary in the cerebellar primordium. Engrailed-2 is involved in the determination of skeletal muscle physiologic properties. Urinary EN2 is a highly specific and sensitive candidate biomarker of prostate cancer.
Rabbit polyclonal anti-ENS antibody reacts with chicken, zebrafish, human, mouse, and rat engrailed homeobox 2 transcription factors.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human EN2

Zastosowanie

Rabbit Anti-EN2 antibody is suitable for use in western blot (0.5μg/ml) assays.
Rabbit polyclonal anti-ENS antibody is used to tag engrailed homeobox 2 transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of engrailed homeobox 2 transcription factor in brain development and skeletal muscle differentiation.

Działania biochem./fizjol.

Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Sekwencja

Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Dokumenty section.

Proszę o kontakt, jeśli potrzebna jest pomoc Obsługa Klienta

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej