HPA017055

Anti-SAMSN1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-Hematopoietic adaptor containing SH3 and SAM domains 1, Anti-SAM domain, SH3 domain and nuclear localization signals protein 1, Anti-SAM domain-containing protein SAMSN-1, Anti-SH3-SAM adaptor protein
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA017055
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: LLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
• UniProt accession no.: Q9NSI8
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SAMSN1(64092)

Description

General description

SAMSN1 (SAM domain, SH3 domain and nuclear localization signals 1) is a cytoplasmic adaptor protein belonging to the SLY family. It is abundantly expressed in the hematopoietic compartment. Its expression to a lesser extent have also been found in heart, brain, placenta, and lung. Generally, they are characterized by the presence of protein-protein interaction domains. It consists of a sterile motif (SAM) domain that is capable of self-association and can also associate with each other. The chimeric fusion of this domain with the ßPDGF receptor, AML1, c-Abl, and JAK2 results in the oncogenic transformation of the SAM domain. The SH3 domains mediate protein-protein interactions in several signal transduction pathways.

Immunogen

SAM domain-containing protein SAMSN-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

SAMSN1 (SAM domain, SH3 domain and nuclear localization signals 1) protein may be involved in the formation of blood vessel during normal brain development. It may function as an adaptor or scaffold protein. It has been found to be overexpressed in glioma cells and is associated with a poor survival in glioblastoma multiforme. SAMSN1 may be involved in B cell activation and differentiation. SAMSN1 has been suggested to be a tumor suppressor in lung cancer. It has also been reported that SAMSN1 may act as a biomarker for the phenotype of human hepatocellular carcinoma.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71505

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves