AV48984

Anti-PCMTD1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-FLJ10883, Anti-Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 41 kDa
• species reactivity: mouse, guinea pig, rat, bovine, dog, human, rabbit, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_443169
• UniProt accession no.: Q96MG8
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... PCMTD1(115294)

Description

General description

Mutations in Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 (PCMTD1) gene are associated with primary angle closure glaucoma (PACG).

Immunogen

Synthetic peptide directed towards the middle region of human PCMTD1

Application

Anti-PCMTD1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Sequence

Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable