MSST0006
SILu™Lite VEGFA Vascular endothelial growth factor A human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Synonym(s):
SILuLite Vascular endothelial growth factor A
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
23201100
NACRES:
NA.12
Recommended Products
biological source
human
Quality Level
recombinant
expressed in HEK 293 cells
Assay
≥98% (SDS-PAGE)
form
lyophilized powder
technique(s)
mass spectrometry (MS): suitable
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... VEGFA(7422)
Related Categories
General description
SILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Biochem/physiol Actions
VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service