Skip to Content
Merck
All Photos(2)

Key Documents

WH0005325M1

Sigma-Aldrich

Monoclonal Anti-PLAGL1 antibody produced in mouse

clone 1E2, ascites fluid

Synonym(s):

Anti-DKFZp781P1017, Anti-LOT1, Anti-ZAC, Anti-ZAC1, Anti-pleiomorphic adenoma gene-like 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

1E2, monoclonal

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

isotype

IgMκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PLAGL1(5325)

General description

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

PLAGL1 (NP_002647.2, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Biochem/physiol Actions

The maternally-imprinted gene, PLAGL1 (pleiomorphic adenoma-like protein 1), functions as an oncogene as well as a tumor suppressor depending on the cell context. It has been found to exhibit anti-proliferative properties and regulate apoptosis and cell-cycle arrest via p53.

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Transcriptional activation capacity of the novel PLAG family of zinc finger proteins.
Kas K
The Journal of Biological Chemistry, 273, 23026-23032 (1998)
The tumorigenic diversity of the three PLAG family members is associated with different DNA binding capacities.
Hensen K
Cancer Research, 62, 1510-1517 (2002)
Anne-Lise Peille et al.
PloS one, 8(11), e80741-e80741 (2013-11-22)
Soft tissue sarcomas (STS) are rare, complex tumors with a poor prognosis. The identification of new prognostic biomarkers is needed to improve patient management. Our aim was to determine the methylation status of the 118 CpG sites in the PLAGL1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service