Skip to Content
Merck
All Photos(1)

Key Documents

SAB1406406

Sigma-Aldrich

Anti-S100A4 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):

18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~11.7 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... S100A4(6275)

General description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Immunogen

S100A4 (NP_002952.1, 1 a.a. ~ 101 a.a) full-length human protein.

Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Li-Jun Yu et al.
Cancer biomarkers : section A of Disease markers, 14(5), 325-333 (2014-08-30)
S100A4 promotes cancer metastasis but is frequently silenced in human cutaneous squamous cell carcinomas/c-SCCs due to DNA methylation, which may explain the less metastasized property of c-SCCs. This study aims to check 1) whether the metastatic potential of S100A4-negative human
H-J Li et al.
European review for medical and pharmacological sciences, 18(6), 817-827 (2014-04-08)
Recent studies showed that the S100A4 is candidate prognostic marker or therapeutic targets in cancers. In this study, we first evaluate the expression of S100A4 mRNA in Wilms tumor (WT) and its relationship to the clinicopathological parameters and prognosis. We
Yong-Chao Lu et al.
The Journal of clinical endocrinology and metabolism, 99(10), 3800-3810 (2014-07-01)
Small-conductance, Ca(2+)-activated K(+) channel 3 (SK3) has been shown to be expressed in porcine endometrium. However, the roles of SK3 in human endometrium during the menstrual cycle and early pregnancy are unknown. The objective of the study was to investigate

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service