Skip to Content
Merck
All Photos(6)

Key Documents

HPA010973

Sigma-Aldrich

Anti-PYY antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-PYY, Anti-PYY-I, Anti-PYY-II, Anti-Peptide YY, Anti-Peptide tyrosine tyrosine

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PYY(5697)

General description

PYY (peptide YY) is a hunger suppressing hormone, composed of 36 amino acids. It is secreted in the mucosa of rectum, colon and distal ileum. Studies show that it is also found on peripheral blood mononuclear cells (PBMC). PYY was initially isolated from the gut of pig, and shares high similarity with neuropeptide Y (NPY) and pancreatic polypeptide (PP). It has a molecular weight of 4307Da. This gene resides on human chromosome 17q21.1.

Immunogen

Peptide YY Precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

PYY (peptide YY) regulates body mass index and body weight, where decreased levels of PYY are associated with obesity and increased BMI. It decreases hunger and food intake, gastrointestinal motility and hormone secretion by pancreas. It also plays a role in regulating energy homeostasis. Studies suggest that its expression is decreased under pro-inflammatory stimuli, and during the differentiation of monocytes to macrophages. PYY concentrations are also reduced in women with high dietary cognitive restraint (CR) as opposed to women with normal CR. This peptide is altered in various gastrointestinal disorders, and might be one of the causes of chronic idiopathic slow transit constipation (CST). It might also be responsible for the symptoms of inflammatory bowel disease and gastroenteropathy due to long-standing diabetes. However, in some gastrointestinal disorder it might have a positive role, as in the case of systemic sclerosis, celiac disease, and post-intestinal resection state.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71923

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Farrell Cahill et al.
PloS one, 9(4), e95235-e95235 (2014-04-20)
PYY is an appetite suppressing hormone. Low circulating PYY has been linked to greater BMI. However data is controversial and this association has not been verified in large human populations. The purpose of this study was to investigate if fasting
Billie Hunne et al.
Cell and tissue research, 378(1), 33-48 (2019-05-03)
This paper provides quantitative data on the distributions of enteroendocrine cells (EEC), defined by the hormones they contain, patterns of colocalisation between hormones and EEC relations to nerve fibres in the rat gastric mucosa. The rat stomach has three mucosal
J L Scheid et al.
Physiology & behavior, 120, 26-33 (2013-07-09)
Acylated ghrelin and peptide YY (PYY3-36) are involved in appetite-regulation and energy homeostasis. These gastrointestinal hormones provide peripheral signals to the central nervous system to regulate appetite and short term food intake, and interact with leptin and insulin to regulate
Fiona M Keane et al.
The FEBS journal, 278(8), 1316-1332 (2011-02-15)
Fibroblast activation protein-α (FAP) is a cell surface-expressed and soluble enzyme of the prolyl oligopeptidase family, which includes dipeptidyl peptidase 4 (DPP4). FAP is not generally expressed in normal adult tissues, but is found at high levels in activated myofibroblasts
Julia Pia Natascha Holler et al.
Peptides, 58, 78-82 (2014-06-28)
Peptide YY is produced by L cells in the mucosa of the distal ileum, colon, and rectum and may have systemic and paracrine functions. We hypothesized that peptide YY is expressed by peripheral blood mononuclear cells. The purpose of the

Global Trade Item Number

SKUGTIN
HPA010973-100UL4061837125584
HPA010973-25UL4061842817214

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service