Skip to Content
Merck
All Photos(1)

Key Documents

AV46164

Sigma-Aldrich

Anti-STIP1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-HOP, Anti-IEF-SSP-3521, Anti-P60, Anti-STI1, Anti-STI1L, Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

rat, horse, mouse, human, dog, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_006810

UniProt accession no.

P31948

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... STIP1(10963)

Immunogen

Synthetic peptide directed towards the N terminal region of human STIP1

Application

Anti-STIP1 (AB1) antibody produced in rabbit can be used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by using western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

Stress-induced-phosphoprotein 1 (STIP1) also referred to as Hsp70/Hsp90-organizing protein, HOP, STI1, STI1L or P60 is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 facilitates the interaction of chaperones Hsp70 and Hsp90 for proper protein folding. Additionally, it assists as a novel biomarker for ovarian cancer. STIP1 secreted by human ovarian cancer cells binds to a bone morphogenetic protein (BMP) receptor, ALK2 (activin A receptor, type II-like kinase 2) and activates SMAD-ID3 signaling pathways. Hence, STIP1-ALK2 pathway promotes cell proliferation in ovarian cancer cells.

Sequence

Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Naomi Walsh et al.
Cancer letters, 306(2), 180-189 (2011-04-08)
We previously identified Hop as over expressed in invasive pancreatic cancer cell lines and malignant tissues of pancreatic cancer patients, suggesting an important role for Hop in the biology of invasive pancreatic cancer. Hop is a co-chaperone protein that binds
Chia-Lung Tsai et al.
Cell reports, 2(2), 283-293 (2012-08-14)
Stress-induced phosphoprotein 1 (STIP1), a cochaperone that organizes other chaperones, heat shock proteins (HSPs), was recently shown to be secreted by human ovarian cancer cells. In neuronal tissues, binding to prion protein was required for STIP1 to activate the ERK
Anna Carolina Carvalho da Fonseca et al.
Journal of neuroimmunology, 274(1-2), 71-77 (2014-07-22)
Factors released by glioma-associated microglia/macrophages (GAMs) play an important role in the growth and infiltration of tumors. We have previously demonstrated that the co-chaperone stress-inducible protein 1 (STI1) secreted by microglia promotes proliferation and migration of human glioblastoma (GBM) cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service